PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000697030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 320aa    MW: 36389.2 Da    PI: 5.5896
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000697030genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.81.3e-50581861129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrF P+deelv++yL kk+++++     ++ e+d++++ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ v++  
  MDP0000697030  58 LPPGFRFYPSDEELVCHYLYKKITNEEALK-GTLVEIDLHTCEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRMVMEPg 152
                    79***********************99544.78***************88888999**************************************98 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                    +ge vg++ktLvfy++rap+g kt W+mhe+rle
  MDP0000697030 153 TGEIVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 186
                    8899***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-6056204IPR003441NAC domain
PROSITE profilePS5100558.30658204IPR003441NAC domain
PfamPF023651.1E-2759185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRTIPRSPI KNLSPDGFNY GENPFEDSMS SGSDMGMAHP IPIRPVAIPW DVDIGATLPP  60
GFRFYPSDEE LVCHYLYKKI TNEEALKGTL VEIDLHTCEP WQLPEVAKLN ANEWYFFSFR  120
DRKYATGFRT NRATTSGYWK ATGKDRMVME PGTGEIVGMR KTLVFYRNRA PNGIKTGWIM  180
HEFRLETPHM PPKEDWVLCR VFHKGKGPEN STKLSPHDFM LETTPCTVPL NLVPSPPTHG  240
QTMPCVYNHN QSNSFLNLLQ LSHQEKYTNS SIPELNAKND CEYGFLWDMN LEDGSFDNGV  300
APNLDEMRFE VDENSMVLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-47322041165NAC domain-containing protein 19
4dul_A4e-47322041165NAC domain-containing protein 19
1ut7_B4e-47322041165NO APICAL MERISTEM PROTEIN
1ut7_A4e-47322041165NO APICAL MERISTEM PROTEIN
1ut4_B4e-47322041165NO APICAL MERISTEM PROTEIN
1ut4_A4e-47322041165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981220.0KF198122.1 Malus hupehensis NAC domain protein (NAC86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008382854.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
TrEMBLS5R6450.0S5R645_9R
STRINGGLYMA13G18620.21e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.19e-89NAC domain containing protein 74